ITGA4 purified MaxPab mouse polyclonal antibody (B01P)
  • ITGA4 purified MaxPab mouse polyclonal antibody (B01P)

ITGA4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003676-B01P
ITGA4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ITGA4 protein.
Información adicional
Size 50 ug
Gene Name ITGA4
Gene Alias CD49D|IA4|MGC90518
Gene Description integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAWEARREPGPRRAAVRETVMLLLCLGVPTGRPYNVDTESALLYQGPHNTLFGYSVVLHSHGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYLGYSV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ITGA4 (AAI56713.1, 1 a.a. ~ 1032 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3676

Enviar un mensaje


ITGA4 purified MaxPab mouse polyclonal antibody (B01P)

ITGA4 purified MaxPab mouse polyclonal antibody (B01P)