ITGA2 monoclonal antibody (M01), clone 2B6
  • ITGA2 monoclonal antibody (M01), clone 2B6

ITGA2 monoclonal antibody (M01), clone 2B6

Ref: AB-H00003673-M01
ITGA2 monoclonal antibody (M01), clone 2B6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ITGA2.
Información adicional
Size 100 ug
Gene Name ITGA2
Gene Alias BR|CD49B|GPIa|VLA-2|VLAA2
Gene Description integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGA2 (NP_002194.2, 30 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3673
Clone Number 2B6
Iso type IgG1 Kappa

Enviar un mensaje


ITGA2 monoclonal antibody (M01), clone 2B6

ITGA2 monoclonal antibody (M01), clone 2B6