ITGA2 polyclonal antibody (A01)
  • ITGA2 polyclonal antibody (A01)

ITGA2 polyclonal antibody (A01)

Ref: AB-H00003673-A01
ITGA2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ITGA2.
Información adicional
Size 50 uL
Gene Name ITGA2
Gene Alias BR|CD49B|GPIa|VLA-2|VLAA2
Gene Description integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGA2 (NP_002194.2, 30 a.a. ~ 119 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3673

Enviar un mensaje


ITGA2 polyclonal antibody (A01)

ITGA2 polyclonal antibody (A01)