IRF4 polyclonal antibody (A01)
  • IRF4 polyclonal antibody (A01)

IRF4 polyclonal antibody (A01)

Ref: AB-H00003662-A01
IRF4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IRF4.
Información adicional
Size 50 uL
Gene Name IRF4
Gene Alias LSIRF|MUM1
Gene Description interferon regulatory factor 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IRF4 (NP_002451, 342 a.a. ~ 451 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3662

Enviar un mensaje


IRF4 polyclonal antibody (A01)

IRF4 polyclonal antibody (A01)