IRF2 polyclonal antibody (A02)
  • IRF2 polyclonal antibody (A02)

IRF2 polyclonal antibody (A02)

Ref: AB-H00003660-A02
IRF2 polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IRF2.
Información adicional
Size 50 uL
Gene Name IRF2
Gene Alias DKFZp686F0244|IRF-2
Gene Description interferon regulatory factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IRF2 (NP_002190, 216 a.a. ~ 315 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3660

Enviar un mensaje


IRF2 polyclonal antibody (A02)

IRF2 polyclonal antibody (A02)