IRF1 purified MaxPab mouse polyclonal antibody (B01P)
  • IRF1 purified MaxPab mouse polyclonal antibody (B01P)

IRF1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003659-B01P
IRF1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IRF1 protein.
Información adicional
Size 50 ug
Gene Name IRF1
Gene Alias IRF-1|MAR
Gene Description interferon regulatory factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IRF1 (NP_002189.1, 1 a.a. ~ 325 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3659

Enviar un mensaje


IRF1 purified MaxPab mouse polyclonal antibody (B01P)

IRF1 purified MaxPab mouse polyclonal antibody (B01P)