ITGA6 monoclonal antibody (M01), clone 4C1
  • ITGA6 monoclonal antibody (M01), clone 4C1

ITGA6 monoclonal antibody (M01), clone 4C1

Ref: AB-H00003655-M01
ITGA6 monoclonal antibody (M01), clone 4C1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ITGA6.
Información adicional
Size 100 ug
Gene Name ITGA6
Gene Alias CD49f|DKFZp686J01244|FLJ18737|ITGA6B|VLA-6
Gene Description integrin, alpha 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGA6 (NP_000201, 24 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3655
Clone Number 4C1
Iso type IgG2a Kappa

Enviar un mensaje


ITGA6 monoclonal antibody (M01), clone 4C1

ITGA6 monoclonal antibody (M01), clone 4C1