ITGA6 purified MaxPab rabbit polyclonal antibody (D01P)
  • ITGA6 purified MaxPab rabbit polyclonal antibody (D01P)

ITGA6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003655-D01P
ITGA6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ITGA6 protein.
Información adicional
Size 100 ug
Gene Name ITGA6
Gene Alias CD49f|DKFZp686J01244|FLJ18737|ITGA6B|VLA-6
Gene Description integrin, alpha 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLRGHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVGGETEHDESLVPVPAN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ITGA6 (NP_000201.2, 1 a.a. ~ 1073 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3655

Enviar un mensaje


ITGA6 purified MaxPab rabbit polyclonal antibody (D01P)

ITGA6 purified MaxPab rabbit polyclonal antibody (D01P)