IRAK1 MaxPab rabbit polyclonal antibody (D01)
  • IRAK1 MaxPab rabbit polyclonal antibody (D01)

IRAK1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003654-D01
IRAK1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IRAK1 protein.
Información adicional
Size 100 uL
Gene Name IRAK1
Gene Alias IRAK|pelle
Gene Description interleukin-1 receptor-associated kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSSIPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTKPGPESSVSLLQGARPSPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWTAVKQS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IRAK1 (AAH14963.1, 1 a.a. ~ 633 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3654

Enviar un mensaje


IRAK1 MaxPab rabbit polyclonal antibody (D01)

IRAK1 MaxPab rabbit polyclonal antibody (D01)