INSRR monoclonal antibody (M03), clone 2C1
  • INSRR monoclonal antibody (M03), clone 2C1

INSRR monoclonal antibody (M03), clone 2C1

Ref: AB-H00003645-M03
INSRR monoclonal antibody (M03), clone 2C1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant INSRR.
Información adicional
Size 100 ug
Gene Name INSRR
Gene Alias IRR
Gene Description insulin receptor-related receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LYLNDYCHRGLRLPTSNNDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNAITIPISPWKVTSINKSPQRDSGRHRRAAGPLRLGGNSSDF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen INSRR (NP_055030, 651 a.a. ~ 760 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3645
Clone Number 2C1
Iso type IgG1 Kappa

Enviar un mensaje


INSRR monoclonal antibody (M03), clone 2C1

INSRR monoclonal antibody (M03), clone 2C1