INSRR monoclonal antibody (M02), clone 5C6
  • INSRR monoclonal antibody (M02), clone 5C6

INSRR monoclonal antibody (M02), clone 5C6

Ref: AB-H00003645-M02
INSRR monoclonal antibody (M02), clone 5C6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant INSRR.
Información adicional
Size 100 ug
Gene Name INSRR
Gene Alias IRR
Gene Description insulin receptor-related receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LYLNDYCHRGLRLPTSNNDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNAITIPISPWKVTSINKSPQRDSGRHRRAAGPLRLGGNSSDF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen INSRR (NP_055030, 651 a.a. ~ 760 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3645
Clone Number 5C6
Iso type IgG1 Kappa

Enviar un mensaje


INSRR monoclonal antibody (M02), clone 5C6

INSRR monoclonal antibody (M02), clone 5C6