INPP5A monoclonal antibody (M05), clone 3D8
  • INPP5A monoclonal antibody (M05), clone 3D8

INPP5A monoclonal antibody (M05), clone 3D8

Ref: AB-H00003632-M05
INPP5A monoclonal antibody (M05), clone 3D8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant INPP5A.
Información adicional
Size 100 ug
Gene Name INPP5A
Gene Alias 5PTASE|DKFZp434A1721|MGC116947|MGC116949
Gene Description inositol polyphosphate-5-phosphatase, 40kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq YFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELVLRVSVCCPSPGHRGMWSAGSGLAQPW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen INPP5A (NP_005530, 288 a.a. ~ 387 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3632
Clone Number 3D8
Iso type IgG2a Kappa

Enviar un mensaje


INPP5A monoclonal antibody (M05), clone 3D8

INPP5A monoclonal antibody (M05), clone 3D8