INPP1 monoclonal antibody (M14), clone 1A6
  • INPP1 monoclonal antibody (M14), clone 1A6

INPP1 monoclonal antibody (M14), clone 1A6

Ref: AB-H00003628-M14
INPP1 monoclonal antibody (M14), clone 1A6

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant INPP1.
Información adicional
Size 100 ug
Gene Name INPP1
Gene Alias MGC110984
Gene Description inositol polyphosphate-1-phosphatase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq MSDILRELLCVSEKAANIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEVIKQNMENKFPGLEKNIFGEESNEFTNDWGEKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVAFTDPTLDSTEINVPQDILGIWVDPIDSTYQYIKGSADIKSNQGIFPCGLQCVTILIGVYDIQTGVPLMGVINQPFVSRDPNTLRWKGQCYWGLSYMGTNMHSLQLTISRRNGSETHTGNTGSEAA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen INPP1 (AAH15496, 1 a.a. ~ 399 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3628
Clone Number 1A6
Iso type IgG2a Kappa

Enviar un mensaje


INPP1 monoclonal antibody (M14), clone 1A6

INPP1 monoclonal antibody (M14), clone 1A6