INPP1 monoclonal antibody (M11A), clone 4F9
  • INPP1 monoclonal antibody (M11A), clone 4F9

INPP1 monoclonal antibody (M11A), clone 4F9

Ref: AB-H00003628-M11A
INPP1 monoclonal antibody (M11A), clone 4F9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant INPP1.
Información adicional
Size 200 uL
Gene Name INPP1
Gene Alias MGC110984
Gene Description inositol polyphosphate-1-phosphatase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq GLVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQLVYHVENEGAAGVDRWANKGGLIAYRSRKRLETFLSLLVQNLAPAETHT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen INPP1 (NP_002185, 300 a.a. ~ 399 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 3628
Clone Number 4F9
Iso type IgG2a Kappa

Enviar un mensaje


INPP1 monoclonal antibody (M11A), clone 4F9

INPP1 monoclonal antibody (M11A), clone 4F9