INPP1 purified MaxPab rabbit polyclonal antibody (D01P)
  • INPP1 purified MaxPab rabbit polyclonal antibody (D01P)

INPP1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003628-D01P
INPP1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human INPP1 protein.
Información adicional
Size 100 ug
Gene Name INPP1
Gene Alias MGC110984
Gene Description inositol polyphosphate-1-phosphatase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MSDILRELLCVSEKAANIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEVIKQNMENKFPGLEKNIFGEESNEFTNDWGEKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVAFTDPTLDSTEINVPQDILGIWVDPIDSTYQYIKGSADIKSNQGIFPCGLQCVTILIGVYDIQTGVPLMGVINQPFVSRDPNTLRWKGQCYWGLSYMGTNMHSLQLTISRRNGSETHTGNTGSEAA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen INPP1 (NP_002185.1, 1 a.a. ~ 399 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3628

Enviar un mensaje


INPP1 purified MaxPab rabbit polyclonal antibody (D01P)

INPP1 purified MaxPab rabbit polyclonal antibody (D01P)