INHBB polyclonal antibody (A01)
  • INHBB polyclonal antibody (A01)

INHBB polyclonal antibody (A01)

Ref: AB-H00003625-A01
INHBB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant INHBB.
Información adicional
Size 50 uL
Gene Name INHBB
Gene Alias MGC157939
Gene Description inhibin, beta B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq GRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen INHBB (NP_002184, 298 a.a. ~ 407 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3625

Enviar un mensaje


INHBB polyclonal antibody (A01)

INHBB polyclonal antibody (A01)