INHA purified MaxPab mouse polyclonal antibody (B01P)
  • INHA purified MaxPab mouse polyclonal antibody (B01P)

INHA purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003623-B01P
INHA purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human INHA protein.
Información adicional
Size 50 ug
Gene Name INHA
Gene Alias -
Gene Description inhibin, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPRRHALGGFTHRGSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLHLATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPSGGERARRSTPLMSWPWSPSALRLLQRPPEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen INHA (ABM84699.1, 1 a.a. ~ 366 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3623

Enviar un mensaje


INHA purified MaxPab mouse polyclonal antibody (B01P)

INHA purified MaxPab mouse polyclonal antibody (B01P)