ING1 monoclonal antibody (M06), clone 2G11
  • ING1 monoclonal antibody (M06), clone 2G11

ING1 monoclonal antibody (M06), clone 2G11

Ref: AB-H00003621-M06
ING1 monoclonal antibody (M06), clone 2G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ING1.
Información adicional
Size 100 ug
Gene Name ING1
Gene Alias p24ING1c|p33|p33ING1|p33ING1b|p47|p47ING1a
Gene Description inhibitor of growth family, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ING1 (NP_937862.1, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3621
Clone Number 2G11
Iso type IgG1 Kappa

Enviar un mensaje


ING1 monoclonal antibody (M06), clone 2G11

ING1 monoclonal antibody (M06), clone 2G11