ING1 MaxPab rabbit polyclonal antibody (D01)
  • ING1 MaxPab rabbit polyclonal antibody (D01)

ING1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003621-D01
ING1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ING1 protein.
Información adicional
Size 100 uL
Gene Name ING1
Gene Alias p24ING1c|p33|p33ING1|p33ING1b|p47|p47ING1a
Gene Description inhibitor of growth family, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ING1 (NP_937862.1, 1 a.a. ~ 279 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3621

Enviar un mensaje


ING1 MaxPab rabbit polyclonal antibody (D01)

ING1 MaxPab rabbit polyclonal antibody (D01)