IMPDH1 purified MaxPab mouse polyclonal antibody (B01P)
  • IMPDH1 purified MaxPab mouse polyclonal antibody (B01P)

IMPDH1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003614-B01P
IMPDH1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IMPDH1 protein.
Información adicional
Size 50 ug
Gene Name IMPDH1
Gene Alias DKFZp781N0678|IMPD|IMPD1|LCA11|RP10|sWSS2608
Gene Description IMP (inosine monophosphate) dehydrogenase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MEGPLTPPPLQGGGAAAVPEPGARQHPGHETAAQRYSARLLQAGYEPESMADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IMPDH1 (NP_899066.1, 1 a.a. ~ 563 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3614

Enviar un mensaje


IMPDH1 purified MaxPab mouse polyclonal antibody (B01P)

IMPDH1 purified MaxPab mouse polyclonal antibody (B01P)