IMPDH1 polyclonal antibody (A01)
  • IMPDH1 polyclonal antibody (A01)

IMPDH1 polyclonal antibody (A01)

Ref: AB-H00003614-A01
IMPDH1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IMPDH1.
Información adicional
Size 50 uL
Gene Name IMPDH1
Gene Alias DKFZp781N0678|IMPD|IMPD1|LCA11|RP10|sWSS2608
Gene Description IMP (inosine monophosphate) dehydrogenase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IMPDH1 (NP_000874, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3614

Enviar un mensaje


IMPDH1 polyclonal antibody (A01)

IMPDH1 polyclonal antibody (A01)