ILF2 polyclonal antibody (A01)
  • ILF2 polyclonal antibody (A01)

ILF2 polyclonal antibody (A01)

Ref: AB-H00003608-A01
ILF2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ILF2.
Información adicional
Size 50 uL
Gene Name ILF2
Gene Alias MGC8391|NF45|PRO3063
Gene Description interleukin enhancer binding factor 2, 45kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ILF2 (NP_004506, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3608

Enviar un mensaje


ILF2 polyclonal antibody (A01)

ILF2 polyclonal antibody (A01)