IL16 purified MaxPab mouse polyclonal antibody (B01P)
  • IL16 purified MaxPab mouse polyclonal antibody (B01P)

IL16 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003603-B01P
IL16 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IL16 protein.
Información adicional
Size 50 ug
Gene Name IL16
Gene Alias FLJ16806|FLJ42735|FLJ44234|HsT19289|IL-16|LCF|prIL-16
Gene Description interleukin 16 (lymphocyte chemoattractant factor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MESHSRAGKSRKSAKFRSISRSLMLCNAKTSDDGSSPDEKYPDPFEISLAQGKEGIFHSSVQLADTSEAGPSSVPDLALASEAAQLQAAGNDRGKTCRRIFFMKESSTASSREKPGKLEAQSSNFLFPKACHQRARSNSTSVNPYCTREIDFPMTKKSAAPTDRQPYSLCSNRKSLSQQLDCPAGKAAGTSRPTRSLSTAQLVQPSGGLQASVISNIVLMKGQAKGLGFSIVGGKDSIYGPIGIYVKTIFAGGAA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL16 (AAH40272.1, 1 a.a. ~ 454 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3603

Enviar un mensaje


IL16 purified MaxPab mouse polyclonal antibody (B01P)

IL16 purified MaxPab mouse polyclonal antibody (B01P)