IL15RA monoclonal antibody (M01), clone 1C5
  • IL15RA monoclonal antibody (M01), clone 1C5

IL15RA monoclonal antibody (M01), clone 1C5

Ref: AB-H00003601-M01
IL15RA monoclonal antibody (M01), clone 1C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL15RA.
Información adicional
Size 100 ug
Gene Name IL15RA
Gene Alias MGC104179
Gene Description interleukin 15 receptor, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL15RA (NP_002180, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3601
Clone Number 1C5
Iso type IgG2b Kappa

Enviar un mensaje


IL15RA monoclonal antibody (M01), clone 1C5

IL15RA monoclonal antibody (M01), clone 1C5