AB-H00003600-M07
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 100 ug |
Gene Name | IL15 |
Gene Alias | IL-15|MGC9721 |
Gene Description | interleukin 15 |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | ELISA |
Immunogen Prot. Seq | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | IL15 (NP_000576, 49 a.a. ~ 162 a.a) full length recombinant protein. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 3600 |
Clone Number | 1G3 |
Iso type | IgG2b Kappa |