IL15 MaxPab rabbit polyclonal antibody (D01)
  • IL15 MaxPab rabbit polyclonal antibody (D01)

IL15 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003600-D01
IL15 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IL15 protein.
Información adicional
Size 100 uL
Gene Name IL15
Gene Alias IL-15|MGC9721
Gene Description interleukin 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL15 (NP_000576.1, 1 a.a. ~ 162 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3600

Enviar un mensaje


IL15 MaxPab rabbit polyclonal antibody (D01)

IL15 MaxPab rabbit polyclonal antibody (D01)