IL15 MaxPab mouse polyclonal antibody (B01P)
  • IL15 MaxPab mouse polyclonal antibody (B01P)

IL15 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003600-B01P
IL15 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IL15 protein.
Información adicional
Size 50 ug
Gene Name IL15
Gene Alias IL-15|MGC9721
Gene Description interleukin 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL15 (NP_000576, 1 a.a. ~ 162 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3600

Enviar un mensaje


IL15 MaxPab mouse polyclonal antibody (B01P)

IL15 MaxPab mouse polyclonal antibody (B01P)