Ver mas grande
IL13RA2 monoclonal antibody (M01J), clone 2E10
AB-H00003598-M01J
Producto nuevo
IL13RA2 monoclonal antibody (M01J), clone 2E10
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | IL13RA2 |
| Gene Alias | CD213A2|IL-13R|IL13BP |
| Gene Description | interleukin 13 receptor, alpha 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab |
| Immunogen Prot. Seq | DTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAET |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | IL13RA2 (NP_000631, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 3598 |
| Clone Number | 20000000000 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant IL13RA2.
This product is belong to Cell Culture Grade Antibody (CX Grade).
This product is belong to Cell Culture Grade Antibody (CX Grade).