IL12RB1 purified MaxPab mouse polyclonal antibody (B01P)
  • IL12RB1 purified MaxPab mouse polyclonal antibody (B01P)

IL12RB1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003594-B01P
IL12RB1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IL12RB1 protein.
Información adicional
Size 50 ug
Gene Name IL12RB1
Gene Alias CD212|IL-12R-BETA1|IL12RB|MGC34454
Gene Description interleukin 12 receptor, beta 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEPLVTWVVPLLFLFLLPRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRRLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL12RB1 (AAH29121, 1 a.a. ~ 381 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3594

Enviar un mensaje


IL12RB1 purified MaxPab mouse polyclonal antibody (B01P)

IL12RB1 purified MaxPab mouse polyclonal antibody (B01P)