IL12B monoclonal antibody (M01), clone 2H6
  • IL12B monoclonal antibody (M01), clone 2H6

IL12B monoclonal antibody (M01), clone 2H6

Ref: AB-H00003593-M01
IL12B monoclonal antibody (M01), clone 2H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL12B.
Información adicional
Size 100 ug
Gene Name IL12B
Gene Alias CLMF|CLMF2|IL-12B|NKSF|NKSF2
Gene Description interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq IRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL12B (NP_002178, 229 a.a. ~ 328 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3593
Clone Number 2H6
Iso type IgG2a Kappa

Enviar un mensaje


IL12B monoclonal antibody (M01), clone 2H6

IL12B monoclonal antibody (M01), clone 2H6