IL11 monoclonal antibody (M04), clone 3C6
  • IL11 monoclonal antibody (M04), clone 3C6

IL11 monoclonal antibody (M04), clone 3C6

Ref: AB-H00003589-M04
IL11 monoclonal antibody (M04), clone 3C6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL11.
Información adicional
Size 100 ug
Gene Name IL11
Gene Alias AGIF|IL-11
Gene Description interleukin 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL11 (NP_000632, 23 a.a.-199 a.a.) partial recombinant protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3589
Clone Number 3C6
Iso type IgG1

Enviar un mensaje


IL11 monoclonal antibody (M04), clone 3C6

IL11 monoclonal antibody (M04), clone 3C6