IL10RB purified MaxPab mouse polyclonal antibody (B02P)
  • IL10RB purified MaxPab mouse polyclonal antibody (B02P)

IL10RB purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00003588-B02P
IL10RB purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IL10RB protein.
Información adicional
Size 50 ug
Gene Name IL10RB
Gene Alias CDW210B|CRF2-4|CRFB4|D21S58|D21S66|IL-10R2
Gene Description interleukin 10 receptor, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL10RB (NP_000619.3, 1 a.a. ~ 325 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3588

Enviar un mensaje


IL10RB purified MaxPab mouse polyclonal antibody (B02P)

IL10RB purified MaxPab mouse polyclonal antibody (B02P)