IL10 monoclonal antibody (M03), clone 1C10
  • IL10 monoclonal antibody (M03), clone 1C10

IL10 monoclonal antibody (M03), clone 1C10

Ref: AB-H00003586-M03
IL10 monoclonal antibody (M03), clone 1C10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL10.
Información adicional
Size 50 ug
Gene Name IL10
Gene Alias CSIF|IL-10|IL10A|MGC126450|MGC126451|TGIF
Gene Description interleukin 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL10 (AAI04253.1, 74 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3586
Clone Number 1C10
Iso type IgG3 Kappa

Enviar un mensaje


IL10 monoclonal antibody (M03), clone 1C10

IL10 monoclonal antibody (M03), clone 1C10