IL10 purified MaxPab rabbit polyclonal antibody (D01P)
  • IL10 purified MaxPab rabbit polyclonal antibody (D01P)

IL10 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003586-D01P
IL10 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IL10 protein.
Información adicional
Size 100 ug
Gene Name IL10
Gene Alias CSIF|IL-10|IL10A|MGC126450|MGC126451|TGIF
Gene Description interleukin 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,PLA-Ce
Immunogen Prot. Seq MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL10 (AAI04253.1, 1 a.a. ~ 178 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3586

Enviar un mensaje


IL10 purified MaxPab rabbit polyclonal antibody (D01P)

IL10 purified MaxPab rabbit polyclonal antibody (D01P)