IL10 polyclonal antibody (A01)
  • IL10 polyclonal antibody (A01)

IL10 polyclonal antibody (A01)

Ref: AB-H00003586-A01
IL10 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IL10.
Información adicional
Size 50 uL
Gene Name IL10
Gene Alias CSIF|IL-10|IL10A|MGC126450|MGC126451|TGIF
Gene Description interleukin 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL10 (AAI04253.1, 74 a.a. ~ 178 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3586

Enviar un mensaje


IL10 polyclonal antibody (A01)

IL10 polyclonal antibody (A01)