IL9 MaxPab mouse polyclonal antibody (B02P)
  • IL9 MaxPab mouse polyclonal antibody (B02P)

IL9 MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00003578-B02P
IL9 MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IL9 protein.
Información adicional
Size 50 ug
Gene Name IL9
Gene Alias HP40|IL-9|P40
Gene Description interleukin 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL9 (NP_000581, 1 a.a. ~ 144 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3578

Enviar un mensaje


IL9 MaxPab mouse polyclonal antibody (B02P)

IL9 MaxPab mouse polyclonal antibody (B02P)