IL7 purified MaxPab rabbit polyclonal antibody (D01P)
  • IL7 purified MaxPab rabbit polyclonal antibody (D01P)

IL7 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003574-D01P
IL7 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IL7 protein.
Información adicional
Size 100 ug
Gene Name IL7
Gene Alias IL-7
Gene Description interleukin 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL7 (AAH47698.1, 1 a.a. ~ 177 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3574

Enviar un mensaje


IL7 purified MaxPab rabbit polyclonal antibody (D01P)

IL7 purified MaxPab rabbit polyclonal antibody (D01P)