IL6ST monoclonal antibody (M02), clone 4A4
  • IL6ST monoclonal antibody (M02), clone 4A4

IL6ST monoclonal antibody (M02), clone 4A4

Ref: AB-H00003572-M02
IL6ST monoclonal antibody (M02), clone 4A4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL6ST.
Información adicional
Size 100 ug
Gene Name IL6ST
Gene Alias CD130|CDw130|GP130|GP130-RAPS|IL6R-beta
Gene Description interleukin 6 signal transducer (gp130, oncostatin M receptor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL6ST (NP_002175, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3572
Clone Number 4A4
Iso type IgG2a Kappa

Enviar un mensaje


IL6ST monoclonal antibody (M02), clone 4A4

IL6ST monoclonal antibody (M02), clone 4A4