IL6R purified MaxPab mouse polyclonal antibody (B01P)
  • IL6R purified MaxPab mouse polyclonal antibody (B01P)

IL6R purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003570-B01P
IL6R purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IL6R protein.
Información adicional
Size 50 ug
Gene Name IL6R
Gene Alias CD126|IL-6R-1|IL-6R-alpha|IL6RA|MGC104991
Gene Description interleukin 6 receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key Flow Cyt,WB-Ce,WB-Tr
Immunogen Prot. Seq MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL6R (NP_000556.1, 1 a.a. ~ 468 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3570

Enviar un mensaje


IL6R purified MaxPab mouse polyclonal antibody (B01P)

IL6R purified MaxPab mouse polyclonal antibody (B01P)