IL6 purified MaxPab rabbit polyclonal antibody (D01P)
  • IL6 purified MaxPab rabbit polyclonal antibody (D01P)

IL6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003569-D01P
IL6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IL6 protein.
Información adicional
Size 100 ug
Gene Name IL6
Gene Alias BSF2|HGF|HSF|IFNB2|IL-6
Gene Description interleukin 6 (interferon, beta 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL6 (AAH15511.1, 1 a.a. ~ 212 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3569

Enviar un mensaje


IL6 purified MaxPab rabbit polyclonal antibody (D01P)

IL6 purified MaxPab rabbit polyclonal antibody (D01P)