IL4R monoclonal antibody (M08), clone 4H8
  • IL4R monoclonal antibody (M08), clone 4H8

IL4R monoclonal antibody (M08), clone 4H8

Ref: AB-H00003566-M08
IL4R monoclonal antibody (M08), clone 4H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL4R.
Información adicional
Size 100 ug
Gene Name IL4R
Gene Alias CD124|IL4RA
Gene Description interleukin 4 receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL4R (NP_000409, 26 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3566
Clone Number 4H8
Iso type IgG2a Kappa

Enviar un mensaje


IL4R monoclonal antibody (M08), clone 4H8

IL4R monoclonal antibody (M08), clone 4H8