IL4R monoclonal antibody (M05A), clone 2C3
  • IL4R monoclonal antibody (M05A), clone 2C3

IL4R monoclonal antibody (M05A), clone 2C3

Ref: AB-H00003566-M05A
IL4R monoclonal antibody (M05A), clone 2C3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL4R.
Información adicional
Size 200 uL
Gene Name IL4R
Gene Alias CD124|IL4RA
Gene Description interleukin 4 receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL4R (NP_000409, 26 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 3566
Clone Number 2C3
Iso type IgG2a Kappa

Enviar un mensaje


IL4R monoclonal antibody (M05A), clone 2C3

IL4R monoclonal antibody (M05A), clone 2C3