IL4R polyclonal antibody (A01)
  • IL4R polyclonal antibody (A01)

IL4R polyclonal antibody (A01)

Ref: AB-H00003566-A01
IL4R polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IL4R.
Información adicional
Size 50 uL
Gene Name IL4R
Gene Alias CD124|IL4RA
Gene Description interleukin 4 receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL4R (NP_000409, 26 a.a. ~ 135 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3566

Enviar un mensaje


IL4R polyclonal antibody (A01)

IL4R polyclonal antibody (A01)