IL2RG polyclonal antibody (A01)
  • IL2RG polyclonal antibody (A01)

IL2RG polyclonal antibody (A01)

Ref: AB-H00003561-A01
IL2RG polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant IL2RG.
Información adicional
Size 50 uL
Gene Name IL2RG
Gene Alias CD132|IMD4|SCIDX|SCIDX1
Gene Description interleukin 2 receptor, gamma (severe combined immunodeficiency)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL2RG (AAH14972, 1 a.a. ~ 369 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3561

Enviar un mensaje


IL2RG polyclonal antibody (A01)

IL2RG polyclonal antibody (A01)