IL1R1 purified MaxPab mouse polyclonal antibody (B01P)
  • IL1R1 purified MaxPab mouse polyclonal antibody (B01P)

IL1R1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003554-B01P
IL1R1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IL1R1 protein.
Información adicional
Size 50 ug
Gene Name IL1R1
Gene Alias CD121A|D2S1473|IL-1R-alpha|IL1R|IL1RA|P80
Gene Description interleukin 1 receptor, type I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key Flow Cyt,WB-Tr
Immunogen Prot. Seq MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL1R1 (NP_000868.1, 1 a.a. ~ 569 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3554

Enviar un mensaje


IL1R1 purified MaxPab mouse polyclonal antibody (B01P)

IL1R1 purified MaxPab mouse polyclonal antibody (B01P)