IL1B purified MaxPab rabbit polyclonal antibody (D01P)
  • IL1B purified MaxPab rabbit polyclonal antibody (D01P)

IL1B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003553-D01P
IL1B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IL1B protein.
Información adicional
Size 100 ug
Gene Name IL1B
Gene Alias IL-1|IL1-BETA|IL1F2
Gene Description interleukin 1, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,PLA-Ce
Immunogen Prot. Seq MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL1B (AAH08678.1, 1 a.a. ~ 269 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3553

Enviar un mensaje


IL1B purified MaxPab rabbit polyclonal antibody (D01P)

IL1B purified MaxPab rabbit polyclonal antibody (D01P)