IKBKB purified MaxPab rabbit polyclonal antibody (D01P)
  • IKBKB purified MaxPab rabbit polyclonal antibody (D01P)

IKBKB purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003551-D01P
IKBKB purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IKBKB protein.
Información adicional
Size 100 ug
Gene Name IKBKB
Gene Alias FLJ40509|IKK-beta|IKK2|IKKB|MGC131801|NFKBIKB
Gene Description inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQCVRMWPGTVAHSCNPSTLGGRGRWI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IKBKB (AAH06231.1, 1 a.a. ~ 256 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3551

Enviar un mensaje


IKBKB purified MaxPab rabbit polyclonal antibody (D01P)

IKBKB purified MaxPab rabbit polyclonal antibody (D01P)