IGLL1 MaxPab rabbit polyclonal antibody (D01)
  • IGLL1 MaxPab rabbit polyclonal antibody (D01)

IGLL1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003543-D01
IGLL1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IGLL1 protein.
Información adicional
Size 100 uL
Gene Name IGLL1
Gene Alias 14.1|CD179b|IGL1|IGL5|IGLJ14.1|IGLL|IGO|IGVPB|VPREB2
Gene Description immunoglobulin lambda-like polypeptide 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MRPGTGQGGLEAPGEPGPNLRQRWPLLLLGLAVVTHGLLRPTAASQSRALGPGAPGGSSRSSLRSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPAECS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IGLL1 (NP_064455.1, 1 a.a. ~ 213 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3543

Enviar un mensaje


IGLL1 MaxPab rabbit polyclonal antibody (D01)

IGLL1 MaxPab rabbit polyclonal antibody (D01)