IGHG3 purified MaxPab mouse polyclonal antibody (B01P)
  • IGHG3 purified MaxPab mouse polyclonal antibody (B01P)

IGHG3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003502-B01P
IGHG3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IGHG3 protein.
Información adicional
Size 50 ug
Gene Name IGHG3
Gene Alias DKFZp686H11213|FLJ39988|FLJ40036|FLJ40253|FLJ40587|FLJ40789|FLJ40834|IgG3|MGC45809
Gene Description immunoglobulin heavy constant gamma 3 (G3m marker)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MEFGLSWVLLVVFLQGVQCEVQLVDSGGGLVQPGGSLRLSCAASGFIVSDHYVEWVRQAPGKGPEWVGCFRSKAHKSTTEYAASVKGRFTILRDDSKNSVHLQMNSLKTDDTAVYYCVRDLEGAGKYDWYFDIWGRGILVTVSSASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IGHG3 (AAH33178.1, 1 a.a. ~ 521 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3502

Enviar un mensaje


IGHG3 purified MaxPab mouse polyclonal antibody (B01P)

IGHG3 purified MaxPab mouse polyclonal antibody (B01P)