IGHA2 purified MaxPab rabbit polyclonal antibody (D01P)
  • IGHA2 purified MaxPab rabbit polyclonal antibody (D01P)

IGHA2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003494-D01P
IGHA2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IGHA2 protein.
Información adicional
Size 100 ug
Gene Name IGHA2
Gene Alias -
Gene Description immunoglobulin heavy constant alpha 2 (A2m marker)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQTAGKGLEWIGYISHSGSTTYNPSLKSRVTLSLDTSKNQFSLRLNSVTAADTAVYYCAHGSSWDFAFDYWGQGTLVTVSSASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQDASGDLYTTSSQLTLPATQCPDGKSVTCHVKHYTNPSQDVTVPCPVPPPPPCCHPRLSLHR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IGHA2 (AAH73765.1, 1 a.a. ~ 477 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3494

Enviar un mensaje


IGHA2 purified MaxPab rabbit polyclonal antibody (D01P)

IGHA2 purified MaxPab rabbit polyclonal antibody (D01P)